| Name | FCER1A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6005 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FCER1A antibody was raised using the middle region of FCER1A corresponding to a region with amino acids IYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNIT |
| Purity/Format | Affinity purified |
| Blocking Peptide | FCER1A Blocking Peptide |
| Description | Rabbit polyclonal FCER1A antibody raised against the middle region of FCER1A |
| Gene | FCER1A |
| Supplier Page | Shop |