Name | FCER1A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6005 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | FCER1A antibody was raised using the middle region of FCER1A corresponding to a region with amino acids IYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNIT |
Purity/Format | Affinity purified |
Blocking Peptide | FCER1A Blocking Peptide |
Description | Rabbit polyclonal FCER1A antibody raised against the middle region of FCER1A |
Gene | FCER1A |
Supplier Page | Shop |