| Name | OXSM antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2413 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP |
| Purity/Format | Affinity purified |
| Blocking Peptide | OXSM Blocking Peptide |
| Description | Rabbit polyclonal OXSM antibody raised against the middle region of OXSM |
| Gene | OXSM |
| Supplier Page | Shop |