Name | TPTE antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5655 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | TPTE antibody was raised using the middle region of TPTE corresponding to a region with amino acids YFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFST |
Purity/Format | Affinity purified |
Blocking Peptide | TPTE Blocking Peptide |
Description | Rabbit polyclonal TPTE antibody raised against the middle region of TPTE |
Gene | TPTE |
Supplier Page | Shop |