| Name | TPTE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5655 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TPTE antibody was raised using the middle region of TPTE corresponding to a region with amino acids YFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFST |
| Purity/Format | Affinity purified |
| Blocking Peptide | TPTE Blocking Peptide |
| Description | Rabbit polyclonal TPTE antibody raised against the middle region of TPTE |
| Gene | TPTE |
| Supplier Page | Shop |