| Name | KCND2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5109 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | KCND2 antibody was raised using the middle region of KCND2 corresponding to a region with amino acids RIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHL |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCND2 Blocking Peptide |
| Description | Rabbit polyclonal KCND2 antibody raised against the middle region of KCND2 |
| Gene | KCND2 |
| Supplier Page | Shop |