| Name | DDC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1296 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | DDC Blocking Peptide |
| Description | Rabbit polyclonal DDC antibody |
| Gene | DDC |
| Supplier Page | Shop |