| Name | HNF4A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2034 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | HNF4A antibody was raised using the middle region of HNF4A corresponding to a region with amino acids LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI |
| Purity/Format | Affinity purified |
| Blocking Peptide | HNF4A Blocking Peptide |
| Description | Rabbit polyclonal HNF4A antibody raised against the middle region of HNF4A |
| Gene | HNF4A |
| Supplier Page | Shop |