| Name | ADA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5862 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ADA antibody was raised using the N terminal of ADA corresponding to a region with amino acids AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA |
| Purity/Format | Affinity purified |
| Blocking Peptide | ADA Blocking Peptide |
| Description | Rabbit polyclonal ADA antibody raised against the N terminal of ADA |
| Gene | ADA |
| Supplier Page | Shop |