CD36 antibody

Name CD36 antibody
Supplier Fitzgerald
Catalog 70R-6098
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CD36 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQV
Purity/Format Affinity purified
Blocking Peptide CD36 Blocking Peptide
Description Rabbit polyclonal CD36 antibody
Gene CD36
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.