| Name | CMAS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2032 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CMAS antibody was raised using the N terminal of CMAS corresponding to a region with amino acids GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF |
| Purity/Format | Affinity purified |
| Blocking Peptide | CMAS Blocking Peptide |
| Description | Rabbit polyclonal CMAS antibody raised against the N terminal of CMAS |
| Gene | CMAS |
| Supplier Page | Shop |