ABAT antibody

Name ABAT antibody
Supplier Fitzgerald
Catalog 70R-2609
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT
Purity/Format Affinity purified
Blocking Peptide ABAT Blocking Peptide
Description Rabbit polyclonal ABAT antibody raised against the middle region of ABAT
Gene ABAT
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.