HLA-DPA1 antibody

• Supplier: Fitzgerald
• Catalog: 70R-5980
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: HLA-DPA1 antibody was raised using the middle region of HLA-DPA1 corresponding to a region with amino acids EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT
• Purity/Format: Affinity purified
• Blocking Peptide: HLA-DPA1 Blocking Peptide
• Description: Rabbit polyclonal HLA-DPA1 antibody raised against the middle region of HLA-DPA1
• Gene: HLA-DPA1