| Name | ECHS1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2490 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ECHS1 antibody was raised using the N terminal of ECHS1 corresponding to a region with amino acids IIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAI |
| Purity/Format | Affinity purified |
| Blocking Peptide | ECHS1 Blocking Peptide |
| Description | Rabbit polyclonal ECHS1 antibody raised against the N terminal of ECHS1 |
| Gene | ECHS1 |
| Supplier Page | Shop |