| Name | C15ORF15 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3901 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C15ORF15 antibody was raised using the middle region of C15Orf15 corresponding to a region with amino acids FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED |
| Purity/Format | Affinity purified |
| Blocking Peptide | C15ORF15 Blocking Peptide |
| Description | Rabbit polyclonal C15ORF15 antibody raised against the middle region of C15Orf15 |
| Gene | RSL24D1 |
| Supplier Page | Shop |