| Name | ACO1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4994 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Rat |
| Antigen | ACO1 antibody was raised using the N terminal of ACO1 corresponding to a region with amino acids MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACO1 Blocking Peptide |
| Description | Rabbit polyclonal ACO1 antibody raised against the N terminal of ACO1 |
| Gene | ACO1 |
| Supplier Page | Shop |