| Name | AMH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6224 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | AMH antibody was raised using the middle region of AMH corresponding to a region with amino acids SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
| Purity/Format | Affinity purified |
| Blocking Peptide | AMH Blocking Peptide |
| Description | Rabbit polyclonal AMH antibody raised against the middle region of AMH |
| Gene | S100A8 |
| Supplier Page | Shop |