| Name | CYP2C9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5321 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CYP2C9 antibody was raised using the C terminal of CYP2C9 corresponding to a region with amino acids AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV |
| Purity/Format | Affinity purified |
| Blocking Peptide | CYP2C9 Blocking Peptide |
| Description | Rabbit polyclonal CYP2C9 antibody raised against the C terminal of CYP2C9 |
| Gene | CYP2C18 |
| Supplier Page | Shop |