DYNC1I2 antibody

Name DYNC1I2 antibody
Supplier Fitzgerald
Catalog 70R-4497
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen DYNC1I2 antibody was raised using the N terminal of DYNC1I2 corresponding to a region with amino acids VAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDH
Purity/Format Affinity purified
Blocking Peptide DYNC1I2 Blocking Peptide
Description Rabbit polyclonal DYNC1I2 antibody raised against the N terminal of DYNC1I2
Gene DYNC1I2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.