Anti-Ceramide synthase 1 antibody
| Name | Anti-Ceramide synthase 1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98062 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 300-349 ( LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR ) of Human LASS1 (NP_067090) |
| Description | Rabbit Polyclonal |
| Gene | CERS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Ceramide synthase 1 antibody (ab98062) at 1 µg/ml (in 5% skim milk / PBS buffer) + OVCAR-3 Cell Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution