Anti-Corticotropin Releasing Factor antibody

Name Anti-Corticotropin Releasing Factor antibody
Supplier Abcam
Catalog ab11133
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC-F
Species Reactivities Rat, Sheep, Human, Mouse, Chicken, Bovine, Dog, Pig
Antigen Synthetic peptide: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA , corresponding to amino acids 148-188 of Sheep CRF
Description Rabbit Polyclonal
Gene CRH
Conjugate Unconjugated
Supplier Page Shop

Product References