Name | Anti-CYP3A7 antibody |
---|---|
Supplier | Abcam |
Catalog | ab98025 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Horse, Monkey |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 453-502 ( KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG ) of Human CYP3A7 (NP_000756) |
Description | Rabbit Polyclonal |
Gene | CYP3A7 |
Conjugate | Unconjugated |
Supplier Page | Shop |