Anti-CYP3A7 antibody

Name Anti-CYP3A7 antibody
Supplier Abcam
Catalog ab98025
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Horse, Monkey
Antigen Synthetic peptide corresponding to a region within internal amino acids 453-502 ( KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG ) of Human CYP3A7 (NP_000756)
Description Rabbit Polyclonal
Gene CYP3A7
Conjugate Unconjugated
Supplier Page Shop

Product images