Human DSS1 full length protein
| Name | Human DSS1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab174412 |
| Category | Protein |
| Applications | MS SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 85 % by SDS-PAGE. ab174412 was purified using conventional chromatography. |
| SwissProt/Accession | P60896 |
| Gene | SHFM1 |
| Residue | 1 to 70 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSMSEKKQPVDLGLLEEDDEFEEFPAEDW AGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of ab174412 (3 µg).