DOG1/TMEM16A Recombinant Protein Antigen

Name DOG1/TMEM16A Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-14296PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody DOG1/TMEM16A Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ANO1
Sequence RVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMEM16A, ANO1
Supplier Page Shop