SP140 Recombinant Protein Antigen

Name SP140 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-81275PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody SP140 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SP140
Sequence SELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNVCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEMDDIAVPQEALSSSPRCEPGFSSESCEQLALPKAGGGDAEDAPSLLPGGGVSCKLAIQIDEGESEEMPKLLP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SP140
Supplier Page Shop