TAS1R1 Recombinant Protein Antigen

Name TAS1R1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-83338PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody TAS1R1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TAS1R1
Sequence IPNDKYQVETMVLLLQKFGWTWISLVGSSDDYGQLGVQALENQATGQGICIAFKDIMPFSAQVGDERMQCLMRHLAQAGATVVVVFSSRQLARVFFESVVLTNLTGKVW
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAS1R1
Supplier Page Shop