ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen

Name ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-33719PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ST8SIA2
Sequence SVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNE
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ST8SIA2
Supplier Page Shop