Recombinant Dog Epididymal secretory protein E1(NPC2)
| Name | Recombinant Dog Epididymal secretory protein E1(NPC2) |
|---|---|
| Supplier | Cusabio |
| Catalog | CSB-YP634688DO |
| Category | Protein |
| Species Reactivities | Dog |
| Nature | Recombinant |
| Source | Yeast |
| Tag/Conjugation | His-tag |
| Purity | >90% (SDS-PAGE) |
| SwissProt/Accession | Q28895 |
| Gene | NPC2 |
| Residue | 22-149aa |
| Sequence | VHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQIEG |
| Description | Full length of the Epididymal secretory protein E1 domain |
| Supplier Page | Shop |
Product images
