COX15 Recombinant Protein Antigen

Name COX15 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86271PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody COX15 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene COX15
Sequence MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVALQSGR
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COX15
Supplier Page Shop