ATP1A4 fusion protein
| Name | ATP1A4 fusion protein |
|---|---|
| Supplier | Proteintech Group |
| Catalog | Ag25297 |
| Category | Protein |
| Prices | $199.00 |
| Sizes | 50 μg |
| Species Reactivities | Human |
| Source | E. coli -derived, PET30a |
| Tag/Conjugation | 6*His |
| Purity | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Bioactivity | Not tested. |
| Endotoxin | Please contact the lab for more information. |
| Gene | ATP1A4 |
| Sequence | MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEE (1 - 42 aa encoded by BC094801 ) |
| Supplier Page | Shop |
Product images
