BNP (64 - 95), rat

Name BNP (64 - 95), rat
Supplier AnaSpec, Inc.
Catalog AS-22931
Category Peptide
Prices $385.00
Sizes 1 mg
Species Reactivities Rat
Purity % Peak Area By HPLC ≥ 95%
Gene Nppb
Sequence NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: 10-26)
Description The BNP-32 is a 32 amino acid peptide of the B-type or brain natriuretic peptide (BNP). BNP was initially isolated from porcine brain but mainly found to be released from cardiomyocytes in response to myocardial stretch and overload resulting from hypervolaemia and increased blood pressure. It is known to suppress the renin-angiotensin-aldosterone system having vasodilatory effects. Processing of BNP prohormones to BNP-32 in higher mammals appears to require a protease with a conserved recognition sequence (RXXR-S).
Supplier Page Shop