EIF5 Recombinant Protein (OPCA01580)

• Supplier: Aviva Systems Biology
• Catalog: OPCA01580
• Category: Protein
• Prices: $250.00
• Sizes: 50 µg
• Nature: Recombinant
• Source: Human
• Tag/Conjugation: His-SUMO-tag
• Purity: Greater than 90% as determined by SDS-PAGE.
• SwissProt/Accession: P55010
• Gene: EIF5
• Sequence: MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGV
• Description: Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex