Lhcgr Recombinant Protein (OPCA01699)

Name Lhcgr Recombinant Protein (OPCA01699)
Supplier Aviva Systems Biology
Catalog OPCA01699
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Rat
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P16235
Gene Lhcgr
Sequence RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPS
Description for both luteinizing hormone and choriogonadotropin; involved in reproductive development and function [RGD, Feb 2006]
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.