OTX2 Recombinant Protein (OPCA01773)

Name OTX2 Recombinant Protein (OPCA01773)
Supplier Aviva Systems Biology
Catalog OPCA01773
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P32243
Gene OTX2
Sequence MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASS
Description This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.