Name | LARP1B Recombinant Protein (OPCA02307) |
---|---|
Supplier | Aviva Systems Biology |
Catalog | OPCA02307 |
Category | Protein |
Prices | $250.00 |
Sizes | 50 µg |
Nature | Recombinant |
Source | Human |
Tag/Conjugation | His-SUMO-tag |
Purity | Greater than 90% as determined by SDS-PAGE. |
SwissProt/Accession | Q659C4 |
Gene | LARP1B |
Sequence | MDSRDHGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE |
Description | This gene encodes a protein containing domains found in the La related protein of Drosophila melanogaster |
Supplier Page | Shop |