Active human IL10 full length protein
| Name | Active human IL10 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab167736 |
| Category | Protein |
| Prices | $239.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . ab167736 was lyophilized from 0.22 µm filtered solution. |
| Bioactivity | The bio-activity was determined by dose-dependent co-stimulation (with recombinant Human IL4 cytokine) of the proliferation of MC/9 cells. The ED 50 <0.5ng/ml, corresponding to a specific activity of >2X10 6 Unit/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P22301 |
| Gene | IL10 |
| Residue | 19 to 178 |
| Sequence | SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKE SLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKT LRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYI EAYMTMKIRN |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab167736 and staining overnight with Coomassie Blue. DTT-reduced protein migrates as 21 kDa protein due to glycosylation.