Active human IL12 p40 full length protein

Name Active human IL12 p40 full length protein
Supplier Abcam
Catalog ab129144
Category Protein
Prices $192.00
Sizes 5 µg
Applications FA SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source Nicotiana benthamiana
Purity > 97 % by SDS-PAGE. ab129144 is purified by sequential chromatography (FPLC).
Bioactivity The biological activity of IL12 p40 is determined by the dose dependent inhibition of IL12 dependent IFN-gamma production (Mouse splenocytes).
Endotoxin < 0.040 Eu/µg
SwissProt/Accession P29460
Gene IL12B
Sequence HHHHHHDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS GECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQII YGKIPAMVVDRCGCS
Supplier Page Shop