| Name | Active human IL17A full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab192095 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 25 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The ED 50 was determined by the dose-dependent proliferation of induction of IL-6 in primary Human foreskin fibroblasts was found to be approximately 2.0 ng/mL, corresponding to a specific activity of > 5.0 x 10 5 units/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q16552 |
| Gene | IL17A |
| Residue | 24 to 155 |
| Sequence | GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSP WNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLR REPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Supplier Page | Shop |