| Name | Active human IL3 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab179618 |
| Category | Protein |
| Prices | $202.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE HPLC FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . Protein Content and Purity determined by Reducing and Non-reducing SDS-PAGE, UV spectroscopy at 280 nm |
| Bioactivity | The activity is determined by the dose-dependent stimulation of TF-1 cells and is typically less than 0.1 ng/mL. |
| Endotoxin | <=1.000 Eu/µg |
| SwissProt/Accession | P08700 |
| Gene | IL3 |
| Residue | 20 to 139 |
| Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILME NNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIK DGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Supplier Page | Shop |