Human Glucose Transporter GLUT4 protein fragment
| Name | Human Glucose Transporter GLUT4 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114176 |
| Category | Protein |
| Applications | SDS-PAGE ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P14672 |
| Gene | SLC2A4 |
| Residue | 467 to 509 |
| Sequence | RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND |
| Supplier Page | Shop |
Product images
ab114176 on a 12.5% SDS-PAGE Stained with Coomassie Blue.