Active human IL8 full length protein

Name Active human IL8 full length protein
Supplier Abcam
Catalog ab192140
Category Protein
Prices $192.00
Sizes 25 µg
Applications SDS-PAGE FA
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity Determined by its ability to chemoattract Human peripheral blood neutrophils using a concentration range of 10.0-100.0 ng/mL.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P10145
Gene CXCL8
Residue 21 to 99
Sequence EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKL SDGRELCLDPKENWVQRVVEKFLKRAENS
Supplier Page Shop