Active human Inhibin beta B protein fragment
| Name | Active human Inhibin beta B protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab129143 |
| Category | Protein |
| Prices | $352.00 |
| Sizes | 5 µg |
| Applications | FA WB SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Nicotiana benthamiana |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 97 % by SDS-PAGE. ab129143 is purified by sequential chromatography (FPLC). |
| Bioactivity | ab129143 activity is measured by its ability to inhibit mouse plasmacytoma cell line (MPC-11) cells proliferation. < 5 ng/mL are required to stimulate a half-maximal response at cytokine saturation. Note: Since applications vary, each investigator should titrate the reagent to obtain optimal results. |
| Endotoxin | < 0.040 Eu/µg |
| SwissProt/Accession | P09529 |
| Gene | INHBB |
| Residue | 293 to 405 |
| Sequence | HHHHHHHHHHGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYC EGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSM LYFDDEYNIVKRDVPNMIVEECG |
| Supplier Page | Shop |
