Human hCG alpha full length protein
| Name | Human hCG alpha full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab201418 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | > 92 % by SDS-PAGE. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P01215 |
| Gene | CGA |
| Residue | 25 to 116 |
| Sequence | APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQ KNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Supplier Page | Shop |
Product images
The purity of ab201418 was determined by DTT-reduced SDS-PAGE and staining overnight with Coomassie Blue. DTT-reduced protein migrates as 22-26 kDa in SDS-PAGE due to glycosylation.