TNPO3 Recombinant Protein Antigen

Name TNPO3 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58965PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody TNPO3 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TNPO3
Sequence RSLDSFLLSPEAAVGLLKGTALVLARLPLDKITECLSELCSVQVMALKKLLSQEPSNGISSDPTVFLDRLAVIFRHTNPIVENGQTHPCQKVIQEIWPVLSETLNKHRAD
Description A recombinant protein to TNPO3
Supplier Page Shop