Human IL8 full length protein

Name Human IL8 full length protein
Supplier Abcam
Catalog ab191925
Category Protein
Applications HPLC SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source HEK 293 cells
Tag/Conjugation His tag C-Terminus
Purity >95% by SDS-PAGE . Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P10145
Gene CXCL8
Residue 21 to 99
Sequence EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKL SDGRELCLDPKENWVQRVVEKFLKRAENSVDHHHHHH
Supplier Page Shop