PLC-beta 4 Recombinant Protein Antigen

Name PLC-beta 4 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58912PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody PLC-beta 4 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PLCB4
Sequence SLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLC-beta 4
Supplier Page Shop