Human N Cadherin protein fragment
| Name | Human N Cadherin protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112268 |
| Category | Protein |
| Applications | Array SDS-PAGE WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | useful for Antibody Production and Protein Array |
| SwissProt/Accession | P19022 |
| Gene | CDH2 |
| Residue | 807 to 906 |
| Sequence | RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLL VFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE Stained with Coomassie Blue.