| Name | Recombinant Canine IFNG protein |
|---|---|
| Supplier | Creative Biomart |
| Catalog | IFNG-7822C |
| Category | Protein |
| Species Reactivities | Dog |
| Nature | Recombinant |
| Source | E.coli |
| Purity | >97% by SDS-PAGE and HPLC analyses. |
| Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using A-72 canine fibroma cells infected with vesicular stomatitis virus (VSV) is less than 2.0 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg. |
| Endotoxin | Less than 0.1 EU/µg of rCaIFN-γ as determined by LAL method. |
| SwissProt/Accession | P42161 |
| Gene | IFNG |
| Sequence | QAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWREESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQIPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK |
| Description | Recombinant Canine IFNG protein was expressed in E.coli. |
| Supplier Page | Shop |