| Name | Recombinant Rat Pdgfb protein |
|---|---|
| Supplier | Creative Biomart |
| Catalog | Pdgfb-975R |
| Category | Protein |
| Species Reactivities | Rat |
| Nature | Recombinant |
| Source | E.coli |
| Purity | >98% by SDS-PAGE and HPLC analyses. |
| Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 2.0 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg. |
| Endotoxin | Less than 0.1 EU/μg of rRtPDGF-BB as determined by LAL method. |
| SwissProt/Accession | Q05028 |
| Gene | Pdgfb |
| Sequence | SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT |
| Description | Recombinant Rat Pdgfb protein was expressed in E.coli. |
| Supplier Page | Shop |