Human Nicotinic Acetylcholine Receptor alpha 5 protein fragment
| Name | Human Nicotinic Acetylcholine Receptor alpha 5 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114513 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P30532 |
| Gene | CHRNA5 |
| Residue | 38 to 131 |
| Sequence | SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVD EKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP |
| Supplier Page | Shop |
Product images
ab114513 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.