Human PARP protein fragment
| Name | Human PARP protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab157069 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >= 99 % by SDS-PAGE. ab157069 was affinity purified on Ni-beads. |
| SwissProt/Accession | P09874 |
| Gene | PARP1 |
| Residue | 385 to 524 |
| Sequence | SADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK EVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAE VKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMK |
| Supplier Page | Shop |
Product images
Total cell extract from E. coli BL21 cells before (lane 1) and after (lane 2) induction of the expression of Human PARP ab157069 with 0.5mM IPTG for 2 hours. Lanes 3-5: Purified Human PARP (BRCT Domain).