Recombinant Rat GRO/KC (CXCL1)

Name Recombinant Rat GRO/KC (CXCL1)
Supplier RayBiotech
Catalog 213-10250-2
Category Protein
Prices $190.00
Sizes 2 µg
Species Reactivities Rat
Nature Recombinant
Source Escherichia coli (E.coli)
Purity 98%
Endotoxin Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).
Gene Cxcl1
Sequence APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREA CLDPEAPMVQKIVQKMLKGVPK
Description All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors
Supplier Page Shop